PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc001950.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 1433aa    MW: 163650 Da    PI: 9.5337
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc001950.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR163.56e-2011291214289
                     FAR1    2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleH 85  
                                Yn+YA++vGFsvrk k++++  +++++++tf Csk g +++e+     +  ++   r+ C a ++   + +g+w vtk e+ H
  Itr_sc001950.1_g00001.1 1129 LYNDYAYRVGFSVRKGKQRYQGSTNNVKMKTFLCSKAGCKSKENVG--VKAYSNIDLRMRCGAFVQFDVNGNGVWTVTKHEKAH 1210
                               7********************99*****************999877..889999****************************** PP

                     FAR1   86 nHel 89  
                               nHel
  Itr_sc001950.1_g00001.1 1211 NHEL 1214
                               ***9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF562193.17E-1046135IPR005135Endonuclease/exonuclease/phosphatase
PROSITE profilePS508788.917361597IPR000477Reverse transcriptase domain
CDDcd016503.13E-41377596No hitNo description
PfamPF000789.5E-25380576IPR000477Reverse transcriptase domain
Gene3DG3DSA:3.30.420.105.0E-5866956IPR012337Ribonuclease H-like domain
SuperFamilySSF530981.07E-10871962IPR012337Ribonuclease H-like domain
CDDcd062223.28E-16875974No hitNo description
PfamPF134562.2E-14876970No hitNo description
PfamPF031013.7E-1611291214IPR004330FAR1 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003676Molecular Functionnucleic acid binding
Sequence ? help Back to Top
Protein Sequence    Length: 1433 aa     Download sequence    Send to blast
MPLNTGAEYV SQQQLAGAIA DDDDLPSKSV ILNSDSQLLS HSLASFRLLG RSGGLAMFWK  60
EEIQLSIVGY SQNHIDTNVQ LENSSMVWRF TGFYGQPERS RRKESWQLLT NLAKSSEFPW  120
LLMGDFNDIL HQKEKRAQKL HQWRSLQVTI CLFFFGLFRL WSVEGCSKAI WDWGKGLTKE  180
FATSLSTARK QMEALRGKCD QQSLRKFAAA QHSYLKVLNQ QNMYWKQRAK IFWYKEGDAN  240
TKFFHNVVRG RRKINKIERL KDNQGIWREK GQELNNLMIS YFQHIFQTFP GDLEKVVDCI  300
DSKITQKQNE ALLVKITFEE VKSATFSMQQ DKFPGPDGLN PGFYQAYWDI LSSDIVQLCN  360
MVLTTGKLPQ GINQTHLVLI PKKNKPEMMS DLRPIALCRV LYKIISKVLS NRMKPLLCNL  420
ISENQSAFVP GRLITDNVML AFETQHFMKR KTQGKEGFAA IKLDVSKAYD RAEWALLRAV  480
MIKMGFDLRW VNLITECVST VSYSILHEGV EIGPIVPQRG LRQAPGAPKI SHLFFADDSF  540
IFIKANQMES IALKEVLKKY GEASGQIINY EKYAVSFSPN VKDEMREQIK HIVEVSVRAG  600
REILLKNVIQ ALPLYAMSTF LLPKEMIKEI ERAMNSFWWR GETEGRRGIN WKEWNKLTAP  660
KNWGGLGFWK LRDFNLAMLS KQAWSLLETQ DIIRKHSRWR VGNGKAIRIW GDKWLPSQVD  720
AEIQTPPFPY LEEAPVSSLM KTGKNEWDDD IVREIFNNRD ASQILSIPLP VMQREDKLIW  780
KEDKKSLFSD WAEYHISTLS EEQVSQMITI CWKIWNARNN KIWNQRTSSS KLVADEGKIF  840
LADWRSIVER DRIRRNQTNQ RIAKWEKPNP GWMKLNSDAA VDERRGAMGL GWVLRDDQGN  900
FIAAISVPGK GVFTPSEAEG MAVREALSWL KVKGITKVQI ETDALLVIQQ LSEDEGVSSF  960
SLLILDIKDI QRLLAARSLL EAFKAFKFGR GALLLRKLCR GPRTQSLIAA EQSTKVFIAA  1020
EFSLAIPLPR NSSLIPQRNP SPIFYRNSSL IAHPNSSPIA DLNSSSIAHR NSSPLLFSIY  1080
IPFVFPILSS LMAETGDQPQ LHIDRSSSIA VDQDLVGIVV SNGDEAYELY NDYAYRVGFS  1140
VRKGKQRYQG STNNVKMKTF LCSKAGCKSK ENVGVKAYSN IDLRMRCGAF VQFDVNGNGV  1200
WTVTKHEKAH NHELYGIRFL KHQSGGSPLV GSRQCNESDF FFDFEVDGDA RLTSYFWRDG  1260
QMRRDYELFG DLLVHDATYR TNKYDMICGP FVGMNHHCMN VIHDCCHLSS VYNITVSSLH  1320
MAYRMVIDYK CHKNPWWTKK VAEGKAVDMG SLSSNVGVAP SIWVVEMTRK FQRLNVSCQD  1380
NSAAKQRCEE AFQSAKKSVE TEVGYVHIEE SDVPSSSGIV QDPSSRRLKG ERN
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06250.13e-16FAR1-related sequence 7